missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TIMELESS Partial ORF (NP_003911, 1109 a.a. - 1207 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00008914-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139645

  • 458.00 € / 25 Mikrogramm


Auf Lager, versandfertig: 5
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: PELQPKVPGEQGSDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRYQIEDDED
Spezifikation

Spezifikation

NP_003911
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PELQPKVPGEQGSDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRYQIEDDED
RUO
TIMELESS
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
8914
TIMELESS (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ12640|FLJ20714|TIM|TIM1|hTIM
TIMELESS
Yes
Videos
Dokumentation