missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TFCP2L3 Partial ORF (NP_079191, 111 a.a. - 210 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00079977-Q01.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16180137

  • 322.00 € / 10 Mikrogramm


Verfügbar ab
24-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

The protein encoded by this gene is a transcription factor that can act as a homodimer or as a heterodimer with either GRHL1 or GRHL3. Defects in this gene are a cause of non-syndromic sensorineural deafness autosomal dominant type 28 (DFNA28)

Sequence: ENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRS
Spezifikation

Spezifikation

NP_079191
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRS
RUO
GRHL2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
79977
TFCP2L3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BOM|DFNA28|FLJ11172|FLJ13782|MGC149294|MGC149295|TFCP2L3
GRHL2
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation