missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SULF1 Partial ORF (NP_055985.1, 780 a.a. - 871 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00023213-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16095315

  • 341.70 € / 10µg

Estimated Shipment: 18-01-2022
Add to basket

Description

Description

Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM]

Sequence: RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
Specifications

Specifications

NP_055985.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.86kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
RUO
SULF1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
23213
SULF1 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ30905/FLJ38022/FLJ41750/HSULF-1/KIAA1077/SULF-1
SULF1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions