missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human STIP1 Partial ORF (AAH02987.1, 160 a.a. - 260 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010963-Q04.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16075285

  • 518.16 € / 25µg

Estimated Shipment: 14-01-2022
Add to basket

Description

Description

STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM]

Sequence: RNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMT
Specifications

Specifications

AAH02987.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMT
RUO
STIP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10963
STIP1 (Human) Recombinant Protein (Q04)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HOP/IEF-SSP-3521/P60/STI1/STI1L
STIP1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions