missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SPTLC2 Partial ORF (NP_004854, 453 a.a. - 561 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009517-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100856

  • 518.16 € / 25µg

Estimated Shipment: 14-01-2022
Add to basket

Description

Description

This gene encodes a long chain base subunit of serine palmitoyltransferase. Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It catalyzes the pyridoxal-5-prime-phosphate-dependent condensation of L-serine and palmitoyl-CoA to 3-oxosphinganine. Mutations in this gene were identified in patients with hereditary sensory neuropathy type I. Alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq]

Sequence: LKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTYEETE
Specifications

Specifications

NP_004854
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTYEETE
RUO
SPTLC2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9517
SPTLC2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0526/LCB2/SPT2
SPTLC2
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions