missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SNAP29 Partial ORF (AAH09715.1, 118 a.a. - 245 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009342-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100426

  • 518.16 € / 25µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq]

Sequence: GLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLD
Specifications

Specifications

AAH09715.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
39.82kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLD
RUO
SNAP29
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9342
SNAP29 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CEDNIK/FLJ21051/SNAP-29
SNAP29
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions