missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC33A1 Partial ORF (NP_004724, 1 a.a. - 69 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009197-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100136

  • 518.16 € / 25µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

The encoded protein is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm. [provided by RefSeq]

Sequence: MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR
Specifications

Specifications

NP_004724
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.33kDa
12.5% SDS-PAGE Stained with Coomassie Blue
MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR
RUO
SLC33A1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9197
SLC33A1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ACATN/AT-1/AT1/SPG42
SLC33A1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions