missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC2A2 Partial ORF (NP_000331.1, 32 a.a. - 98 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00006514-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor. [provided by RefSeq]
Sequence: NAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSSpecifications
| NP_000331.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.11kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| NAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWS | |
| RUO | |
| SLC2A2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 6514 | |
| SLC2A2 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GLUT2 | |
| SLC2A2 | |
| Recombinant | |
| wheat germ expression system |