missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC28A2 Partial ORF (NP_004203.1, 1 a.a. - 79 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009153-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100076

  • 320.54 € / 10µg


Estimated Shipment
07-06-2021
Add to basket

Description

Description

Sequence: MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHARLFKK
Specifications

Specifications

NP_004203.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.43kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHARLFKK
RUO
SLC28A2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9153
SLC28A2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CNT2|HCNT2|HsT17153|MGC138252|SPNT1
SLC28A2
Yes
Videos
SDS
Documents