missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RPS16 Partial ORF (NP_001011, 48 a.a. - 146 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00006217-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16184725

  • 467.00 € / 25 Mikrogramm


Verfügbar ab
17-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: QYKLLEPVLLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCESKKFGGPGARARYQKSYR
Spezifikation

Spezifikation

NP_001011
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QYKLLEPVLLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCESKKFGGPGARARYQKSYR
RUO
RPS16
Yes
wheat germ expression system
Liquid
6217
RPS16 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RPS16
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation