missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RAPGEF4 Partial ORF (AAH24004, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00011069-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16186112

  • 467.00 € / 25 Mikrogramm


Verfügbar ab
24-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIG
Spezifikation

Spezifikation

AAH24004
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIG
RUO
RAPGEF4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
11069
RAPGEF4 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CAMP-GEFII|CGEF2|EPAC2|Nbla00496
RAPGEF4
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation