missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PTCH Partial ORF (NP_000255, 841 a.a. - 940 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005727-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16074605

  • 341.70 € / 10µg

Estimated Shipment: 14-01-2022
Add to basket

Description

Description

This gene encodes a member of the patched gene family. The encoded protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis, as well as the desert hedgehog and indian hedgehog proteins. This gene functions as a tumor suppressor. Mutations of this gene have been associated with basal cell nevus syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences and biological validity cannot be determined currently. [provided by RefSeq]

Sequence: PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQAN
Specifications

Specifications

NP_000255
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQAN
RUO
PTCH1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5727
PTCH (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BCNS/FLJ26746/FLJ42602/HPE7/NBCCS/PTC/PTC1/PTCH/PTCH11
PTCH1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions