missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PRH1 Full-length ORF (AAH64553.1, 17 a.a. - 187 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00005554-P02.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139511

  • 302.00 € / 10 Mikrogramm


Verfügbar ab
30-09-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: QDLNEDVSQEDVPLVISDGGDSEQFLDEERQGPPLGGQQSQPSAGDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ
Spezifikation

Spezifikation

AAH64553.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
45.21kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC74956|Pa
PRH1
Yes
wheat germ expression system
Liquid
5554
PRH1 (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue
QDLNEDVSQEDVPLVISDGGDSEQFLDEERQGPPLGGQQSQPSAGDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ
RUO
PRH1
Wheat Germ (in vitro)
GST
Videos
Dokumentation