missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PPP1R9B Partial ORF (NP_115984, 708 a.a. - 817 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 € - 508.00 €
Specifications
| Accession Number | NP_115984 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 84687 |
| Molecular Weight (g/mol) | 37.84kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16110847
|
Abnova™
H00084687-Q01.25UG |
25 ug |
508.00 €
25µg |
Estimated Shipment: 31-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16100847
|
Abnova™
H00084687-Q01.10UG |
10 ug |
335.00 €
10µg |
Estimated Shipment: 31-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
Spinophilin is a regulatory subunit of protein phosphatase-1 catalytic subunit (PP1; see MIM 176875) and is highly enriched in dendritic spines, specialized protrusions from dendritic shafts that receive most of the excitatory input in the central nervous system (Allen et al., 1997 [PubMed 9275233]).[supplied by OMIM]
Sequence: QLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNSTSpecifications
| NP_115984 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.84kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ30345/PPP1R6/PPP1R9/SPINO/Spn | |
| PPP1R9B | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 84687 | |
| PPP1R9B (Human) Recombinant Protein (Q01) | |
| QLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST | |
| RUO | |
| PPP1R9B | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |