missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human POLRMT Partial ORF (NP_005026.2, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005442-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16084535

  • 341.70 € / 10µg

Estimated Shipment: 14-01-2022
Add to basket

Description

Description

This gene encodes a mitochondrial DNA-directed RNA polymerase. The gene product is responsible for mitochondrial gene expression as well as for providing RNA primers for initiation of replication of the mitochondrial genome. Although this polypeptide has the same function as the three nuclear DNA-directed RNA polymerases, it is more closely related to RNA polymerases of phage and mitochondrial polymerases of lower eukaryotes. [provided by RefSeq]

Sequence: MSALCWGRGAAGLKRALRPCGRPGLPGKEGTAGGVCGPRRSSSASPQEQDQDRRKDWGHVELLEVLQARVRQLQAESVSEVVVNRVDVARLPECGSGDGS
Specifications

Specifications

NP_005026.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MSALCWGRGAAGLKRALRPCGRPGLPGKEGTAGGVCGPRRSSSASPQEQDQDRRKDWGHVELLEVLQARVRQLQAESVSEVVVNRVDVARLPECGSGDGS
RUO
POLRMT
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5442
POLRMT (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
APOLMT/MTRNAP/MTRPOL/h-mtRPOL
POLRMT
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions