missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human POLR3G Partial ORF (NP_006458.1, 44 a.a. - 104 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human POLR3G Partial ORF (NP_006458.1, 44 a.a. - 104 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16182916
Price: 508.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00010622-Q01.25ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16182916

508.00 € / 25µg

Estimated Shipment: 29-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: KPVPLKTGEGEEYMLALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYQEEWIPDWR

Specifications

Accession Number	NP_006458.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	32.45kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	KPVPLKTGEGEEYMLALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYQEEWIPDWR
Regulatory Status	RUO
Common Name	POLR3G
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	10622
Name	POLR3G (Human) Recombinant Protein (Q01)
Quantity	25 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	RPC32/RPC7
Gene Symbol	POLR3G
Recombinant	Recombinant
Expression System	wheat germ expression system

Product Suggestions

Abnova™ Human POLR3G Partial ORF (NP_006458.1, 44 a.a. - 104 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Promotions