missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PGAP1 Partial ORF (NP_079265, 168 a.a. - 266 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00080055-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100167

  • 341.70 € / 10µg

Estimated Shipment: 21-01-2022
Add to basket

Description

Description

PGAP1 catalyzes the inositol deacylation of glycosylphosphatidylinositol (GPI) at an early step in GPI biosynthesis. Inositol deacylation is essential for the generation of mature GPI capable of attachment to proteins (Tanaka et al., 2004 [PubMed 14734546]).[supplied by OMIM]

Sequence: VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL
Specifications

Specifications

NP_079265
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VAIIGHSMGGLVARALLTLKNFKHDLINLLITQATPHVAPVMPLDRFITDFYTTVNNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHHTSAL
RUO
PGAP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
80055
PGAP1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Bst1/FLJ42774/ISPD3024
PGAP1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions