missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PDE3B Partial ORF (NP_000913, 401 a.a. - 500 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human PDE3B Partial ORF (NP_000913, 401 a.a. - 500 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16182505
Price: 335.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00005140-Q01.10ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16182505

335.00 € / 10µg

Estimated Shipment: 03-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH

Specifications

Accession Number	NP_000913
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	36.74kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH
Regulatory Status	RUO
Common Name	PDE3B
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	5140
Name	PDE3B (Human) Recombinant Protein (Q01)
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	HcGIP1/cGIPDE1
Gene Symbol	PDE3B
Recombinant	Recombinant
Expression System	wheat germ expression system

Product Suggestions

Abnova™ Human PDE3B Partial ORF (NP_000913, 401 a.a. - 500 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Promotions