missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PDE3B Partial ORF (NP_000913, 401 a.a. - 500 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00005140-Q01.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16182505

  • 310.00 € / 10 Mikrogramm


Verfügbar ab
18-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH
Spezifikation

Spezifikation

NP_000913
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTH
RUO
PDE3B
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5140
PDE3B (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HcGIP1|cGIPDE1
PDE3B
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation