missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PCDHGA8 Partial ORF (NP_114477, 357 a.a. - 444 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00009708-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16181196

  • 467.00 € / 25 Mikrogramm


Verfügbar ab
19-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: LENSLPGTVIAFLSVHDQDSGKNGQVVCYTRDNLPFKLEKSIGNYYRLVTRKYLDRENVSIYNITVMASDLGTPPLSTETQIALHVAD
Spezifikation

Spezifikation

NP_114477
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.42kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LENSLPGTVIAFLSVHDQDSGKNGQVVCYTRDNLPFKLEKSIGNYYRLVTRKYLDRENVSIYNITVMASDLGTPPLSTETQIALHVAD
RUO
PCDHGA8
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9708
PCDHGA8 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0327|PCDH-GAMMA-A8
PCDHGA8
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation