missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human OPHN1 Partial ORF (NP_002538, 641 a.a. - 734 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004983-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138591

  • 335.00 € / 10µg
Estimated Shipment: 28-08-2024
to see stock.

Description

Description

This gene encodes a Rho-GTPase-activating protein that promotes GTP hydrolysis of Rho subfamily members. Rho proteins are important mediators of intracellular signal transduction, which affects cell migration and cell morphogenesis. Mutations in this gene are responsible for OPHN1-related X-linked mental retardation with cerebellar hypoplasia and distinctive facial dysmorhphism. [provided by RefSeq]

Sequence: QRSGETDPGRKSPSRPILDGKLEPCPEVDVGKLVSRLQDGGTKITPKATNGPMPGSGPTKTPSFHIKRPAPRPLAHHKEGDADSFSKVRPPGEK
Specifications

Specifications

NP_002538
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.08kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QRSGETDPGRKSPSRPILDGKLEPCPEVDVGKLVSRLQDGGTKITPKATNGPMPGSGPTKTPSFHIKRPAPRPLAHHKEGDADSFSKVRPPGEK
RUO
OPHN1
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
4983
OPHN1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MRX60/OPN1
OPHN1
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions