missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NUT Partial ORF (NP_786883.1, 1033 a.a. - 1132 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00256646-Q01.25ug

Detalles adicionales : Gewicht : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16182627

  • 467.00 € / 25 Mikrogramm


Verfügbar ab
22-02-2021
Añadir a la cesta

Descripción

Descripción

Sequence: REHPLSPHHASGGQGSQRASHLLPAGAKGPSKLPYPVAKSGKRALAGGPAPTEKTPHSGAQLGVPREKPLALGVVRPSQPRKRRCDSFVTGRRKKRRRSQ
Especificaciones

Especificaciones

NP_786883.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
REHPLSPHHASGGQGSQRASHLLPAGAKGPSKLPYPVAKSGKRALAGGPAPTEKTPHSGAQLGVPREKPLALGVVRPSQPRKRRCDSFVTGRRKKRRRSQ
RUO
C15orf55
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
256646
NUT (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp434O192|MGC138683|MGC138684|NUT
C15orf55
Yes
Videos
SDS
Documentos