missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NRBP Partial ORF (AAH01221, 436 a.a. - 535 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00029959-Q01.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16186196

  • 310.00 € / 10 Mikrogramm


Verfügbar ab
16-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: PAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS
Spezifikation

Spezifikation

AAH01221
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS
RUO
NRBP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
29959
NRBP (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BCON3|FLJ27109|FLJ35541|MADM|MUDPNP|NRBP
NRBP1
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation