missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NKX2-8 Partial ORF (NP_055175.2, 3 a.a. - 50 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00026257-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16075385

  • 518.16 € / 25µg

Estimated Shipment: 14-01-2022
Add to basket

Description

Description

Sequence: TSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGH
Specifications

Specifications

NP_055175.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.02kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGH
RUO
NKX2-8
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
26257
NKX2-8 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NKX2.8/NKX2H/Nkx2-9
NKX2-8
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions