missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NDST4 Partial ORF (NP_072091, 122 a.a. - 214 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00064579-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139676

  • 458.00 € / 25 Mikrogramm


Verfügbar ab
23-09-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: DNGKGKYTLVIYENILKYVSMDSWNRELLEKYCVEYSVSIIGFHKANENSLPSTQLKGFPLNLFNNLALKDCFVNPQSPLLHITKAPKVEKGP
Spezifikation

Spezifikation

NP_072091
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.97kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DNGKGKYTLVIYENILKYVSMDSWNRELLEKYCVEYSVSIIGFHKANENSLPSTQLKGFPLNLFNNLALKDCFVNPQSPLLHITKAPKVEKGP
RUO
NDST4
Yes
wheat germ expression system
Liquid
64579
NDST4 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NDST4
Wheat Germ (in vitro)
GST
Videos
Dokumentation