missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MTL5 Partial ORF (NP_004914, 399 a.a. - 508 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009633-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16101086

  • 341.70 € / 10µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. This gene encodes a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: GCKNYEESPERKTLMSMPNYMQTGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGRCLSQILHTEFKSKGLKME
Specifications

Specifications

NP_004914
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GCKNYEESPERKTLMSMPNYMQTGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGRCLSQILHTEFKSKGLKME
RUO
MTL5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9633
MTL5 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CXCDC2/MTLT/TESMIN
MTL5
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions