missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MSTN Partial ORF (NP_005250.1, 241 a.a. - 310 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002660-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16094055

  • 518.16 € / 25µg

Estimated Shipment: 14-01-2022
Add to basket

Description

Description

The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. This gene is thought to encode a secreted protein which negatively regulates skeletal muscle growth. [provided by RefSeq]

Sequence: FPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS
Specifications

Specifications

NP_005250.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.33kDa
12.5% SDS-PAGE Stained with Coomassie Blue
FPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS
RUO
MSTN
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2660
MSTN (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GDF8
MSTN
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions