missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MPP1 Partial ORF (NP_002427, 1 a.a. - 98 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004354-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16101355

  • 341.70 € / 10µg

Estimated Shipment: 21-01-2022
Add to basket

Description

Description

Palmitoylated membrane protein 1 is the prototype of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. Palmitoylated membrane protein 1 contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in signal transduction. [provided by RefSeq]

Sequence: MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVAR
Specifications

Specifications

NP_002427
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVAR
RUO
MPP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4354
MPP1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AAG12/DXS552/DXS552E/EMP55/MRG1/PEMP
MPP1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions