missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MOGAT2 Partial ORF (NP_079374, 44 a.a. - 106 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00080168-Q01.10ug
Weitere Details : Gewicht : 0.00010kg
Beschreibung
Sequence: TRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGSpezifikation
| NP_079374 | |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.67kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| TRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAG | |
| RUO | |
| MOGAT2 | |
| Wheat Germ (in vitro) | |
| GST |
| wheat germ expression system | |
| Liquid | |
| 80168 | |
| MOGAT2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DGAT2L5|FLJ22644|MGAT2|MGC119183|MGC119184|MGC119185 | |
| MOGAT2 | |
| Yes |