missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MGC27348 Full-length ORF (AAH26177.1, 1 a.a. - 172 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00256355-P01.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139713

  • 302.00 € / 10 Mikrogramm


Verfügbar ab
23-09-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: MKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVRKETRAGQRTRFKAFVAIRDYNGYAGRVEVLQGGGRRHPRGHHPDQALHCHRAQRLLGEQDRQAPHRPLQGDRPLRLCAGALHPRAQGHWHRLSSCAQEAAHDSWYLRLLHLSQGLHCHPGQLRQRHLGCCL
Spezifikation

Spezifikation

AAH26177.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
46.1kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC27348
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
256355
MGC27348 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVRKETRAGQRTRFKAFVAIRDYNGYAGRVEVLQGGGRRHPRGHHPDQALHCHRAQRLLGEQDRQAPHRPLQGDRPLRLCAGALHPRAQGHWHRLSSCAQEAAHDSWYLRLLHLSQGLHCHPGQLRQRHLGCCL
RUO
MGC27348
Yes
Videos
Dokumentation