missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MAP3K13 Partial ORF (NP_004712.1, 711 a.a. - 810 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009175-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100096

  • 320.54 € / 10µg


Estimated Shipment
07-06-2021
Add to basket

Description

Description

The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase contains a dual leucine-zipper motif, and has been shown to form dimers/oligomers through its leucine-zipper motif. This kinase can phosphorylate and activate MAPK8/JNK, MAP2K7/MKK7, which suggests a role in the JNK signaling pathway. [provided by RefSeq]

Sequence: SEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQK
Specifications

Specifications

NP_004712.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQK
RUO
MAP3K13
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9175
MAP3K13 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LZK|MGC133196
MAP3K13
Yes
Videos
SDS
Documents