missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LOC285697 Full-length ORF (XP_210642.1, 1 a.a. - 183 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00285697-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100044

  • 341.70 € / 10µg

Estimated Shipment: 21-01-2022
Add to basket

Description

Description

Sequence: MPRGLKGSNKDGIPEDLDGNLEEPRDQEGELRSQDVMDLTEGDKETSASAPPAAKRLKTDTKGKKERKPTVDAEEAQRMTTLLSAMSEEQLARYEVCRQSAFPKARIAALMQSITGSSVSENVAIAMAGIAKVLVGEVVEEALDVCEMWGEMPPLQPKHLREAVRRLKPKGLFPNSNYKKFMF
Specifications

Specifications

XP_210642.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
46.6kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LOC285697
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
285697
LOC285697 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MPRGLKGSNKDGIPEDLDGNLEEPRDQEGELRSQDVMDLTEGDKETSASAPPAAKRLKTDTKGKKERKPTVDAEEAQRMTTLLSAMSEEQLARYEVCRQSAFPKARIAALMQSITGSSVSENVAIAMAGIAKVLVGEVVEEALDVCEMWGEMPPLQPKHLREAVRRLKPKGLFPNSNYKKFMF
RUO
LOC285697
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions