missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LMO1 Partial ORF (NP_002306.1, 15 a.a. - 156 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004004-Q02.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16084295

  • 518.16 € / 25µg

Estimated Shipment: 18-01-2022
Add to basket

Description

Description

LMO1 enocdes a cysteine-rich, two LIM domain transcriptional regulator. It is mapped to an area of consistent chromosomal translocation in chromosome 11, disrupting it in T-cell leukemia, although more rarely than the related gene, LMO2 is disrupted. [provided by RefSeq]

Sequence: VQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ
Specifications

Specifications

NP_002306.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
41.25kDa
12.5% SDS-PAGE Stained with Coomassie Blue
VQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ
RUO
LMO1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4004
LMO1 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC116692/RBTN1/RHOM1/TTG1
LMO1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions