missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LHX9 Partial ORF (NP_001014434.1, 291 a.a. - 388 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00056956-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16075595

  • 341.70 € / 10µg

Estimated Shipment: 14-01-2022
Add to basket

Description

Description

This gene encodes a member of the LIM homeobox gene family of developmentally expressed transcription factors. The encoded protein contains a homeodomain and two cysteine-rich zinc-binding LIM domains involved in protein-protein interactions. The protein is highly similar to a mouse protein that causes gonadal agenesis when inactivated, suggesting a role in gonadal development. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: LAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF
Specifications

Specifications

NP_001014434.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF
RUO
LHX9
Yes
wheat germ expression system
Liquid
56956
LHX9 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LHX9
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions