missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LCN1 Partial ORF (NP_002288, 24 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003933-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100605

  • 518.16 € / 25µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. [provided by RefSeq]

Sequence: SDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE
Specifications

Specifications

NP_002288
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.41kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE
RUO
LCN1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3933
LCN1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC71975/PMFA/TP/VEGP
LCN1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions