missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KLF2 Partial ORF (NP_057354, 263 a.a. - 350 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human KLF2 Partial ORF (NP_057354, 263 a.a. - 350 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16075235
Price: 335.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00010365-Q03.10ug

Additional Details : Weight : 0.02000kg

View more versions of this product

Product Code. 16075235

335.00 € / 10µg

Estimated Shipment: 31-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH

Specifications

Accession Number	NP_057354
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	35.42kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH
Regulatory Status	RUO
Common Name	KLF2
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	10365
Name	KLF2 (Human) Recombinant Protein (Q03)
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	LKLF
Gene Symbol	KLF2
Recombinant	Recombinant
Expression System	wheat germ expression system

Product Suggestions

Abnova™ Human KLF2 Partial ORF (NP_057354, 263 a.a. - 350 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Promotions