missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KLF2 Partial ORF (NP_057354, 263 a.a. - 350 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010365-Q03.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16085235

  • 518.16 € / 25µg

Estimated Shipment: 21-01-2022
Add to basket

Description

Description

Sequence: SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH
Specifications

Specifications

NP_057354
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.42kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH
RUO
KLF2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10365
KLF2 (Human) Recombinant Protein (Q03)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LKLF
KLF2
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions