missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KIF9 Partial ORF (NP_878905.1, 691 a.a. - 789 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00064147-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139556

  • 458.00 € / 25 Mikrogramm


Verfügbar ab
23-09-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: VDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKTMMGLQQAHR
Spezifikation

Spezifikation

NP_878905.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKTMMGLQQAHR
RUO
KIF9
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
64147
KIF9 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC104186
KIF9
Yes
Videos
Dokumentation