Abnova™ Human KIF9 Partial ORF (NP_878905.1, 691 a.a. - 789 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human KIF9 Partial ORF (NP_878905.1, 691 a.a. - 789 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16139556
Price: 508.00 EUR

Used for AP, Array, ELISA, WB-Re

Marque: Abnova™ H00064147-Q01.25ug

Informations supplémentaires : Weight : 0.00010kg

Afficher plus de versions de ce produit

Code produit. 16139556

508.00 € / 25µg

Estimated Shipment: 05-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: VDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKTMMGLQQAHR

Spécification

Accession Number	NP_878905.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	36.63kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	VDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKTMMGLQQAHR
Regulatory Status	RUO
Common Name	KIF9
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	64147
Name	KIF9 (Human) Recombinant Protein (Q01)
Quantity	25 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	MGC104186
Gene Symbol	KIF9
Recombinant	Recombinant
Expression System	wheat germ expression system

Suggestions de produits

Abnova™ Human KIF9 Partial ORF (NP_878905.1, 691 a.a. - 789 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Spécification

Suggestions de produits

Documents

Promotions