missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HAND2 Partial ORF (NP_068808.1, 135 a.a. - 216 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009464-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16085165

  • 341.70 € / 10µg

Estimated Shipment: 10-01-2022
Add to basket

Description

Description

The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development. [provided by RefSeq]

Sequence: LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK
Specifications

Specifications

NP_068808.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.76kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK
RUO
HAND2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9464
HAND2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DHAND2/FLJ16260/Hed/MGC125303/MGC125304/Thing2/bHLHa26/dHand
HAND2
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions