missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GRM7 Partial ORF (NP_000835, 431 a.a. - 520 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00002917-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16185781

  • 467.00 € / 25 Mikrogramm


Verfügbar ab
24-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

L-glutamate is the major excitatory neurotransmitter in the central nervous system, and it activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors that have been divided into three groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5, and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3, while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: ADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPA
Spezifikation

Spezifikation

NP_000835
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPA
RUO
GRM7
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2917
GRM7 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ40498|GLUR7|GPRC1G|MGLUR7|mGlu7
GRM7
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation