missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GRCC9 Partial ORF (AAH02983, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00084727-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100877

  • 341.70 € / 10µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHA
Specifications

Specifications

AAH02983
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHA
RUO
SPSB2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
84727
GRCC9 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GRCC9/MGC2519/SSB-2/SSB2
SPSB2
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions