missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GAL3ST4 Partial ORF (NP_078913.3, 388 a.a. - 486 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00079690-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100047

  • 482.88 € / 25µg


Estimated Shipment
07-06-2021
Add to basket

Description

Description

This gene encodes a member of the galactose-3-O-sulfotransferase protein family. The product of this gene catalyzes sulfonation by transferring a sulfate to the C-3' position of galactose residues in O-linked glycoproteins. This enzyme is highly specific for core 1 structures, with asialofetuin, Gal-beta-1,3-GalNAc and Gal-beta-1,3 (GlcNAc-beta-1,6)GalNAc being good substrates. [provided by RefSeq]

Sequence: RLQTAVAELRARREALAKHCLVGGEASDPKYITDRRFRPFQFGSAKVLGYILRSGLSPQDQEECERLATPELQYKDKLDAKQFPPTVSLPLKTSRPLSP
Specifications

Specifications

NP_078913.3
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RLQTAVAELRARREALAKHCLVGGEASDPKYITDRRFRPFQFGSAKVLGYILRSGLSPQDQEECERLATPELQYKDKLDAKQFPPTVSLPLKTSRPLSP
RUO
GAL3ST4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
79690
GAL3ST4 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ12116|GAL3ST-4
GAL3ST4
Yes
Videos
SDS
Documents