missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FLJ42875 Full-length ORF (AAH29785.1, 1 a.a. - 157 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human FLJ42875 Full-length ORF (AAH29785.1, 1 a.a. - 157 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16100724
Price: 508.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00440556-P01.25ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16100724

508.00 € / 25µg

Estimated Shipment: 03-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MGRGAGPAPPQRKSPAEPGWAGAGGGGALGLLPWILRGRHRFPAQIRTQIRLPRLPRLQGAQSCSQLVARAPDGGSAHWPLPLLFLAPEIETVNLNSLDLLPLGPGGSRIQAQPGSLRRCRKPPTTPTRVRPILGQDAAVAEPLGVCNGELPRRWGQ

Specifications

Accession Number	AAH29785.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	43kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	DKFZp761G0122/MGC35434
Gene Symbol	FLJ42875
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	440556
Name	FLJ42875 (Human) Recombinant Protein (P01)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MGRGAGPAPPQRKSPAEPGWAGAGGGGALGLLPWILRGRHRFPAQIRTQIRLPRLPRLQGAQSCSQLVARAPDGGSAHWPLPLLFLAPEIETVNLNSLDLLPLGPGGSRIQAQPGSLRRCRKPPTTPTRVRPILGQDAAVAEPLGVCNGELPRRWGQ
Regulatory Status	RUO
Common Name	FLJ42875
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Product Suggestions

Abnova™ Human FLJ42875 Full-length ORF (AAH29785.1, 1 a.a. - 157 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Promotions