missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FBP2 Partial ORF (NP_003828, 240 a.a. - 339 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00008789-Q01.10ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139255

  • 302.00 € / 10 Mikrogramm


Verfügbar ab
22-09-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: PYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
Spezifikation

Spezifikation

NP_003828
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
RUO
FBP2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
8789
FBP2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC142192
FBP2
Yes
Videos
Dokumentation