missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EHMT1 Partial ORF (NP_079033, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00079813-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100087

  • 320.54 € / 10µg


Estimated Shipment
07-06-2021
Add to basket

Description

Description

The protein encoded by this gene is a histone methyltransferase that is part of the E2F6 complex, which represses transcription. The encoded protein methylates the Lys-9 position of histone H3, which tags it for transcriptional repression. This protein may be involved in the silencing of MYC- and E2F-responsive genes and therefore could play a role in the G0/G1 cell cycle transition. Defects in this gene are a cause of chromosome 9q subtelomeric deletion syndrome (9q-syndrome). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPA
Specifications

Specifications

NP_079033
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPA
RUO
EHMT1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
79813
EHMT1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DEL9q34|DKFZp667M072|EUHMTASE1|Eu-HMTase1|FLJ12879|FP13812|GLP|KIAA1876|KMT1D|bA188C12.1
EHMT1
Yes
Videos
SDS
Documents