missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EED Partial ORF (NP_003788.2, 342 a.a. - 441 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00008726-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16139125

  • 458.00 € / 25 Mikrogramm


Verfügbar ab
29-09-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: KIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR
Spezifikation

Spezifikation

NP_003788.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR
RUO
EED
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
8726
EED (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HEED|WAIT1
EED
Yes
Videos
Dokumentation