missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DIP2A Partial ORF (NP_055966, 107 a.a. - 301 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00023181-Q03.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16075315

  • 518.16 € / 25µg

Estimated Shipment: 14-01-2022
Add to basket

Description

Description

The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: KYKERKMPMPSKRRSVLVHSSVETYTPPDTSSASEDEGSLRRPGRLTSTPLQSHSSVEPWLDRVIQGSSTSSSASSTSSHPGGRPTTAPSAAATPGAAATTALAGLEAHTHIDLHSAPPDVTTGLVEHSYFERPQVASVRSVPRGCSGSMLETADGVPVNSRVSSKIQQLLNTLKRPKRPPLKEFFVDDFEELLE
Specifications

Specifications

NP_055966
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
47.275kDa
12.5% SDS-PAGE Stained with Coomassie Blue
KYKERKMPMPSKRRSVLVHSSVETYTPPDTSSASEDEGSLRRPGRLTSTPLQSHSSVEPWLDRVIQGSSTSSSASSTSSHPGGRPTTAPSAAATPGAAATTALAGLEAHTHIDLHSAPPDVTTGLVEHSYFERPQVASVRSVPRGCSGSMLETADGVPVNSRVSSKIQQLLNTLKRPKRPPLKEFFVDDFEELLE
RUO
DIP2A
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
23181
DIP2A (Human) Recombinant Protein (Q03)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C21orf106/DIP2
DIP2A
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions