missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CNTNAP4 Partial ORF (NP_207837, 1145 a.a. - 1244 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00085445-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16101037

  • 518.16 € / 25µg

Estimated Shipment: 30-12-2021
Add to basket

Description

Description

This gene product belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq]

Sequence: VLGRILEHSDVDQETALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSA
Specifications

Specifications

NP_207837
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VLGRILEHSDVDQETALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSA
RUO
CNTNAP4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
85445
CNTNAP4 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CASPR4/KIAA1763
CNTNAP4
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions