missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CDC42BPB Partial ORF (AAD37506, 1580 a.a. - 1679 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009578-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100976

  • 518.16 € / 25µg

Estimated Shipment: 30-12-2021
Add to basket

Description

Description

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein contains a Cdc42/Rac-binding p21 binding domain resembling that of PAK kinase. The kinase domain of this protein is most closely related to that of myotonic dystrophy kinase-related ROK. Studies of the similar gene in rat suggested that this kinase may act as a downstream effector of Cdc42 in cytoskeletal reorganization. [provided by RefSeq]

Sequence: SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP
Specifications

Specifications

AAD37506
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP
RUO
CDC42BPB
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9578
CDC42BPB (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA1124/MRCKB
CDC42BPB
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions