missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human C4B Partial ORF (NP_000343, 774 a.a. - 873 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00000721-Q02.25ug
Weitere Details : Gewicht : 0.00010kg
Beschreibung
Sequence: VRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVESpezifikation
| NP_000343 | |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| VRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVE | |
| RUO | |
| C4B | |
| Wheat Germ (in vitro) | |
| GST |
| wheat germ expression system | |
| Liquid | |
| 721 | |
| C4B (Human) Recombinant Protein (Q02) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| C4A|C4A13|C4A91|C4B1|C4B12|C4B2|C4B3|C4B5|C4F|CH|CO4|CPAMD3|FLJ60561|MGC164979 | |
| C4B | |
| Yes |