missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human C20orf172 Partial ORF (NP_079194.2, 257 a.a. - 355 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00079980-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100147

  • 341.70 € / 10µg

Estimated Shipment: 30-12-2021
Add to basket

Description

Description

This gene encodes a kinetochore protein that functions as part of the minichromosome instability-12 centromere complex. The encoded protein is required for proper kinetochore assembly and progression through the cell cycle. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: MTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGSGSGSC
Specifications

Specifications

NP_079194.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGSGSGSC
RUO
DSN1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
79980
C20orf172 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C20orf172/FLJ13346/MGC32987/MIS13/dJ469A13.2
DSN1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions